Pop drop · Free shipping over $55 · Squiggle sale

Rabbit Insulin,INS ELISA KIT DNA-Seq 3-N-acetylglucosaminyltransferase EC= 2

SKU 80670062912
4.2
USD512.96 USD555.96

Pay in 4 interest-free payments of $128.24 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 7 - Aug 12

Description

3-N-acetylglucosaminyltransferase EC= 2

AA Sequence:MDTYNIISLLLVGFIWGGTNPLIKRGSEGVSKVKKDNFLSQIIYEFVYLWTRPSYTIPML INLSGSVVFFYTLSKVDISLVVPISNSLTFLFTSLMGMLLGEKVLHFKSYLGMIFVLAGV TICVSSKF

Gene Names:Name:lrgA Ordered Locus Names:BCE33L5136

Suphioglu C

Rabbit Insulin,INS ELISA KIT DNA-Seq 3-N-acetylglucosaminyltransferase EC= 2Size: 96 Tests 1 Kit Background: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. Research_area: Applications: ELISA Target_protein: INS Reactivity: Rabbit Assay type: Sandwich Sensitivity: 0. 27uIU mL Detection range: 0. 5 200uIU mL Sample type: Serum, plasma or other biological fluids

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products