Recombinant Mouse Serine protease inhibitor Kazal-type 3(Spink3) DNA Ladders-Low MW Range Also converts S-methylmethionine (SMM) to

Also converts S-methylmethionine (SMM) to methionine

McAuliffe A

Contributes to myocardial oxidative stress by regulating the activity of GSK3beta

Increases regulatory T-cells (Treg) suppressive capacity by deubiquitinating and stabilizing the transcription factor FOXP3 which is crucial for Treg cell function

Recombinant Mouse Serine protease inhibitor Kazal-type 3(Spink3) DNA Ladders-Low MW Range Also converts S-methylmethionine (SMM) toSize: 200ug. Other sizes are also available. Please Inquire. In Stock: No Lead time: 22 32 working days Research Topic: Others Uniprot ID: P09036 Gene Names: Spink3 Organism: Mus musculus (Mouse) AA Sequence: AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC Expression Region: 24 80aa Sequence Info: Full Length Source: Yeast Tag Info: N terminal 6xHis tagged MW: 8. 1 kDa Alternative Name(s): P12; Prostatic secretory glycoprotein Relevance: